Wisp2 Recombinant Protein
Product Sizes
100 ug
OPCA02559-100UG
1 mg
OPCA02559-1MG
20 ug
OPCA02559-20UG
About this Product
- SKU:
- OPCA02559
- Additional Names:
- CCN;CCN family member 5;connective tissue growth factor-like protein;Crg;Crgr4;Ctgfl;CTGF-L;rC;Rcop1;Wi;Wisp2;WISP-2;WNT1 inducible signaling pathway protein 2.|cellular communication network factor 5
- Buffer:
- Liquid or Lyophilized powder
- Extra Details:
- May play an important role in modulating bone turnover. Promotes the adhesion of osteoblast cells and inhibits the binding of fibrinogen to integrin receptors. In addition, inhibits osteocalcin production (By similarity).
- Formulation:
- Liquid or Lyophilized powder
- Immunogen:
- Ccn5
- Molecular Weight:
- 40.5 kda
- Purity:
- >90%
- Reactivities:
- Mouse
- Sequence:
- QLCPAPCACPWTPPQCPPGVPLVLDGCGCCRVCARRLGESCDHLHVCDPSQGLVCQPGAGPSGRGAVCLFEEDDGSCEVNGRRYLDGETFKPNCRVLCRCDDGGFTCLPLCSEDVRLPSWDCPRPRRIQVPGRCCPEWVCDQAVMQPAIQPSSAQGHQLSALVTPASADGPCPNWSTAWGPCSTTCGLGIATRVSNQNRFCQLEIQRRLCLSRPCLASRSHGSWNSAF
- Shipping Conditions:
- Blue Ice
- Source:
- Mouse
- Storage Conditions:
- -20[o]C
- Supplier:
- Aviva Systems Biology
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Manufacturer's Data Sheet:html_datasheet.php
