Recombinant E.coli 30S ribosomal protein S19
Product Sizes
20 ug
OPCA00766-20UG
100 ug
OPCA00766-100UG
1 mg
OPCA00766-1MG
About this Product
- SKU:
- OPCA00766
- Additional Names:
- 30S ribosomal subunit protein S19|30S ribosomal subunit protein S19;b3316;ECK3303;Small ribosomal subunit protein uS19.
- Buffer:
- Liquid or Lyophilized powder
- Extra Details:
- In the E.coli 70S ribosome in the initiation state (PubMed:12809609) it has been modeled to contact the 23S rRNA of the 50S subunit forming part of bridge B1a; this bridge is broken in the model with bound EF-G. The 23S rRNA contact site in bridge B1a is modeled to differ in different ribosomal states (PubMed:12859903), contacting alternately S13 or S19. In the 3.5 angstroms resolved ribosome structures (PubMed:16272117) the contacts between L5, S13 and S19 bridge B1b are different, confirming the dynamic nature of this interaction. Bridge B1a is not visible in the crystallized ribosomes due to 23S rRNA disorder.
- Formulation:
- Liquid or Lyophilized powder
- Immunogen:
- rpsS
- Molecular Weight:
- 14.3 kDa
- Purity:
- >90%
- Reactivities:
- Bacteria
- Sequence:
- PRSLKKGPFIDLHLLKKVEKAVESGDKKPLRTWSRRSTIFPNMIGLTIAVHNGRQHVPVFVTDEMVGHKLGEFAPTRTYRGHAADKKAKKK
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C
- Supplier:
- Aviva Systems Biology
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Manufacturer's Data Sheet:html_datasheet.php