ABflo[R] 594 Rabbit anti-Human CD261/TRAIL-R1 monoclonal antibody
Product Sizes
100 tests
A24702-100TESTS
200 tests
A24702-200TESTS
500 tests
A24702-500TESTS
About this Product
- SKU:
- A24702
- Additional Names:
- APO2|CD261|DR4|TNF receptor superfamily member 10a|TNFRSF10A|TRAILR-1|TRAILR1
- Application:
- Flow Cytometry
- Clonality:
- Monoclonal
- Conjugate:
- ABflo® 647
- Host:
- Rabbit
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Isotype:
- IgG
- Molecular Weight:
- 50kda
- Purification:
- Affinity Purified
- Reactivities:
- Human
- Sequence:
- EHSPLGELCPPGSHRSEHPGACNRCTEGVGYTNASNNLFACLPCTACKSDEEERSPCTTTRNTACQCKPGTFRNDNSAEMCRKCSRGCPRGMVKVKDCTPWSDIECVHK
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- 2-8[o]C Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Antibody: Monoclonal Antibody
- Manufacturer's Data Sheet:A24702




