LL 37 (human) biotinylated, pegylated
About this Product
- SKU:
- AM-200
- Additional Names:
- Biotin-[PEG(4)][LL-37, 37 aa]OH, [LL-37, 37 aa], LL 37 (human) biotinylated, pegylated is the N-terminally biotinylated, biotin, pegylated chain, PEG(4), antimicrobial, antitumour, antiviral, immunomodulatory, chemotaxis, angiogenesis, LL37, AM-200, AM200, LL-37
- Conjugate:
- Biotin
- Extra Details:
- LL 37 (human) biotinylated, pegylated is the N-terminally biotinylated version of the host defence peptide LL 37 with a biotin group attached via a pegylated chain, PEG(4). The presence of the biotin tag allows numerous biochemical and microbiological applications. LL 37, derived from the C-terminal of human cathelicidin antimicrobial peptide (CAMP, hCAP18), has antimicrobial, antitumour, antiviral and immunomodulatory properties and also has physiological functions in chemotaxis, promotion of wound closure, and angiogenesis.
- Immunogen:
- Antibacterials
- Molecular Weight:
- 4967
- Physical State:
- Freeze dried solid
- Purity:
- >95%
- References:
- <p>Kahlenberg and Kaplan (2013) Little peptide, big effects: the role of LL-37 in inflammation and autoimmune disease. J. Immunol. <strong>191</strong>(10) 4895 https://doi.org/10.4049/jimmunol.1302005 </p><p>Bandurska et al (2015) Unique features of human cathelicidin LL-37. BioFactors <strong>41</strong> 289 doi:10.1002/biof.1225 </p><p>Chen et al (2018) Roles and Mechanisms of Human Cathelicidin LL-37 in Cancer. Cell Physiol.Biochem. <strong>47</strong> 1060 doi: 10.1159/000490183</p>
- Sequence:
- Biotin-[PEG(4)]-Leu-Leu-Gly-Asp-Phe-Phe-Arg-Lys-Ser-Lys-Glu-Lys-Ile-Gly-Lys-Glu-Phe-Lys-Arg-Ile-Val-Gln-Arg-Ile-Lys-Asp-Phe-Leu-Arg-Asn-Leu-Val-Pro-Arg-Thr-Glu-Ser-OH
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- Store frozen, dessicated and in the dark
- Size:
- 1 mg
- Supplier:
- Isca Biochemicals
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Peptides
- Solubility:
- Soluble in water
- Formula:
- C226H376N64O59S
