ATP5O Recombinant Protein (Human)
Product Sizes
100 ug
OPCA00497-100UG
1 mg
OPCA00497-1MG
About this Product
- SKU:
- OPCA00497
- Additional Names:
- ATP synthase peripheral stalk subunit OSCP|ATP synthase subunit O, mitochondrial;ATP synthase, H+ transporting, mitochondrial F1 complex, O subunit;ATP5O;ATPO;HMC08D05;human ATP synthase OSCP subunit;Oligomycin sensitivity conferral protein;oligomycin sensitivity conferral protein oscp-like protein;oligomycin sensitivity conferring protein;OSCP.
- Buffer:
- Liquid or Lyophilized powder
- Extra Details:
- Mitochondrial membrane ATP synthase (F(1)F(0) ATP synthase or Complex V) produces ATP from ADP in the presence of a proton gradient across the membrane which is generated by electron transport complexes of the respiratory chain. F-type ATPases consist of two structural domains, F(1) - containing the extramembraneous catalytic core and F(0) - containing the membrane proton channel, linked together by a central stalk and a peripheral stalk. During catalysis, ATP synthesis in the catalytic domain of F(1) is coupled via a rotary mechanism of the central stalk subunits to proton translocation. Part of the complex F(0) domain and the peripheric stalk, which acts as a stator to hold the catalytic alpha(3)beta(3) subcomplex and subunit a/ATP6 static relative to the rotary elements.
- Formulation:
- Liquid or Lyophilized powder
- Immunogen:
- ATP5PO
- Molecular Weight:
- 47.9 kda
- Purity:
- >90%
- Reactivities:
- Human
- Sequence:
- FAKLVRPPVQVYGIEGRYATALYSAASKQNKLEQVEKELLRVAQILKEPKVAASVLNPYVKRSIKVKSLNDITAKERFSPLTTNLINLLAENGRLSNTQGVVSAFSTMMSVHRGEVPCTVTSASPLEEATLSELKTVLKSFLSQGQVLKLEAKTDPSILGGMIVRIGEKYVDMSVKTKIQKLGRAMREIV
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C
- Supplier:
- Aviva Systems Biology
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Manufacturer's Data Sheet:html_datasheet.php
