IL-22 receptor antagonist (E117A)
Product Sizes
10 ug
£365.00
500-033-10UG
50 ug
£729.00
500-033-50UG
About this Product
- SKU:
- 500-033
- Additional Names:
- IL22; IL-22; Iltif; IL-22a; ILTIFa
- Extra Details:
- IL-22 is a member of the IL-10 family of regulatory cytokines which includes IL-10, IL-19, IL-20, IL-22, IL-24 and IL-26. Members of this family share partial homology in their amino acid sequences, but they are dissimilar in their biological functions. Produced by T lymphocytes, IL-22 inhibits IL-4 production by Th2 cells, and induces acute phase reactants in the liver and pancreas. IL-22 signals through a receptor system consisting of IL-10R-beta/CRF2-4 and IL-22R, both of which are members of the class II cytokine-receptor family. Recombinant murine IL-22 mutant E117A (numbering according to human IL-22 including signal peptide) produced in E.coli is a single, non-glycosylated polypeptide chain containing 147 amino acids and having a molecular mass of 16.7 kDa. Preparation of recombinant mIL-22 antagonists provides new tools for the study of IL-22 activity and of eventual therapeutic means for attenuating its negative effects. For more details see L. Niv-Spector et al. Protein Eng Des Sel. (PEDS) 25:397-404 (2012).
- Formulation:
- lyophilized
- Host:
- Insect/Arthropod
- Molecular Weight:
- 16.7 kDa
- Purity:
- > 98.0% as determined by Gel filtration and SDS-PAGE gel.
- Reactivities:
- Mouse
- Sequence:
- ALPVNTRCKLEVSNFQQPYIVNAAFMLAKEASLADNNTDVRLIGEKLFRGVSAKDQCYLMKQVLNFTLEDVLLPQSDRFQPYMQAVVPFLTKLSNQLSSCHISGDDQNIQKNVRRLKETVKKLGESGEIKAIGELDLLFMSLRNACV
- Shipping Conditions:
- Ambient
- Storage Conditions:
- Room Temperature
- Supplier:
- ReliaTech
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins