IHC-plus[TM] CSNK1A1 / CK1 Alpha Antibody (aa100-200)
Product Sizes
50 ul
LS-B16565-50UL
About this Product
- SKU:
- LS-B16565
- Additional Names:
- CSNK1A1, CK1 alpha, CK1a, CK1alpha, Clock regulator kinase, CK1, Casein kinase 1 alpha, CKIa, CKIalpha, Down-regulated in lung cancer, HLCDGP1, PRO2975, Casein kinase 1, alpha 1, Casein kinase I alpha, Casein kinase I isoform alpha, CKI-alpha
- Application:
- IHC-Paraffin, Immunofluorescence, Western Blot
- Buffer:
- PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol
- Clonality:
- Polyclonal
- Concentration:
- 1.55 mg/ml
- Host:
- Rabbit
- Immunogen:
- A synthetic peptide corresponding to a sequence within amino acids 100-200 of human CSNK1A1 (NP_001020276.1).
- Isotype:
- IgG
- Purification:
- Affinity Purified
- Reactivities:
- Human, Mouse, Rat
- Shipping Conditions:
- Ambient
- Specificity:
- LFNFCSRRFTMKTVLMLADQMISRIEYVHTKNFIHRDIKPDNFLMGIGRHCNKCLESPVGKRKRSMTVSTSQDPSFSGLNQLFLIDFGLAKKYRDNRTRQH
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Type:
- Antibody: Polyclonal Antibody
- Manufacturer's Data Sheet:848062
