Growth Hormone Releasing Factor GRF (1-44) amide human
Product Sizes
0.5 mg
ECH-531-66-0.5MG
1 mg
ECH-531-66-1MG
About this Product
- SKU:
- ECH-531-66
- Extra Details:
- CAS Number: 83930-13-6Molecular Weight: 5036.66Salt Form: TFAPurity: >95%Sequence (3-letter): Tyr-Ala-Asp-Ala-Ile-Phe-Thr-Asn-Ser-Tyr-Arg-Lys-Val-Leu-Gly-Gln-Leu-Ser-Ala-Arg-Lys-Leu-Leu-Gln-Asp-Ile-Met-Ser-Arg-Gln-Gln-Gly-Glu-Ser-Asn-Gln-Glu-Arg-Gly-Ala-Arg-Ala-Arg-Leu-NH2Sequence (1-letter): YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGESNQERGARARL(NH2)Storage: -20 °C or belowGrowth Hormone Releasing Factor (GRF) (1-44) is a 44-aminoacid peptide hormone released by the hypothalamus and acts on the adenohypophyse to stimulate the secretion of growth hormone.
- Molecular Weight:
- 5036.66
- Sequence:
- Tyr-Ala-Asp-Ala-Ile-Phe-Thr-Asn-Ser-Tyr-Arg-Lys-Val-Leu-Gly-Gln-Leu-Ser-Ala-Arg-Lys-Leu-Leu-Gln-Asp-Ile-Met-Ser-Arg-Gln-Gln-Gly-Glu-Ser-Asn-Gln-Glu-Arg-Gly-Ala-Arg-Ala-Arg-Leu-NH2
- Shipping Conditions:
- Ambient
- Storage Conditions:
- -20[o]C
- Supplier:
- Echelon Biosciences
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Peptides
- Manufacturer's Data Sheet:https://www.echelon-inc.com/product/growth-hormone-releasing-factor-grf-1-44-amide-human/

