ATP6AP2 Recombinant Protein (Human)
Product Sizes
20 ug
OPCA05165-20UG
100 ug
OPCA05165-100UG
About this Product
- SKU:
- OPCA05165
- Additional Names:
- APT6M8-9;ATP6IP2;ATP6M8-9;ATPase H(+)-transporting lysosomal accessory protein 2;ATPase H(+)-transporting lysosomal-interacting protein 2;ATPase, H+ transporting, lysosomal (vacuolar proton pump) membrane sector associated protein M8-9;ATPase, H+ transporting, lysosomal accessory protein 2;ATPase, H+ transporting, lysosomal interacting protein 2;CDG2R;ELDF10;embryonic liver differentiation factor 10;ER-localized type I transmembrane adapter;ER-localized type I transmembrane adaptor;HT028;M8-9;MRXE;MRXSH;MSTP009;N14F;prorenin receptor;PRR;renin receptor;renin/prorenin receptor;RENR;vacuolar ATP synthase membrane sector-associated protein M8-9;vacuolar proton ATP synthase membrane sector associated protein M8-9;V-ATPase M8.9 subunit;XMRE;XPDS.|ATPase H+ transporting accessory protein 2
- Buffer:
- Liquid or Lyophilized powder
- Extra Details:
- Functions as a renin and prorenin cellular receptor. May mediate renin-dependent cellular responses by activating ERK1 and ERK2. By increasing the catalytic efficiency of renin in AGT/angiotensinogen conversion to angiotensin I, it may also play a role in the renin-angiotensin system (RAS).
- Formulation:
- Liquid or Lyophilized powder
- Immunogen:
- ATP6AP2
- Molecular Weight:
- 40 kDa
- Purity:
- >90%
- Reactivities:
- Human
- Sequence:
- NEFSILKSPGSVVFRNGNWPIPGERIPDVAALSMGFSVKEDLSWPGLAVGNLFHRPRATVMVMVKGVNKLALPPGSVISYPLENAVPFSLDSVANSIHSLFSEETPVVLQLAPSEERVYMVGKANSVFEDLSVTLRQLRNRLFQENSVLSSLPLNSLSRNNEVDLLFLSELQVLHDISSLLSRHKHLAKDHSPDLYSLELAGLDEIGKRYGEDSEQFRDASKILVDALQKFADDMYSLYGGNAVVELVTVKSFDTSLIRKTRTILEAKQAKNPASPYNLAYKYNFEYSVVFNMVLWIMIALALAVIITSYNIWNMDPGYDSIIYRMTNQKIRMD
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C
- Supplier:
- Aviva Systems Biology
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Manufacturer's Data Sheet:html_datasheet.php
