anti-AGO2 / Argonaute 2 antibody
About this Product
- SKU:
- ARG59343
- Additional Names:
- EC 3.1.26.n2; eIF2C 2; PPD; Protein slicer; Argonaute RISC catalytic component 2; EIF2C2; Argonaute2; PAZ Piwi domain protein; Q10; hAgo2; Protein argonaute-2; Eukaryotic translation initiation factor 2C 2; eIF-2C 2
- Application:
- Western Blot
- Buffer:
- 0.9% NaCl, 0.2% Na2HPO4, 0.05% Sodium azide and 5% BSA.
- CE/IVD:
- RUO
- Clonality:
- Polyclonal
- Concentration:
- 0.5 mg/ml
- Extra Details:
- This gene encodes a member of the Argonaute family of proteins which play a role in RNA interference. The encoded protein is highly basic, and contains a PAZ domain and a PIWI domain. It may interact with dicer1 and play a role in short-interfering-RNA-mediated gene silencing. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Sep 2009]
- Host:
- Rabbit
- Immunogen:
- Synthetic peptide corresponding to aa. 129-169 of Human AGO2 / Argonaute 2. (KVSIKWVSCVSLQALHDALSGRLPSVPFETIQALDVVMRHL)
- Isotype:
- IgG
- Purification:
- Affinity Purified
- Reactivities:
- Bovine, Canine, Hamster, Horse, Human, Mouse, Non-human Primate, Rabbit, Rat
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C
- Supplier:
- Arigo Biolaboratories
- Type:
- Antibody: Polyclonal Antibody
- Manufacturer's Data Sheet:ARG59343.html
