FBXW7 monoclonal antibody (M02), clone 3D1

Product Sizes

100 ug

H00055294-M02-100UG

About this Product

SKU:: H00055294-M02
Application:: ELISA, IHC-Paraffin, Western Blot
translate.label.attr.clone:: 3D1
Clonality:: Monoclonal
Extra Details:: Mouse monoclonal antibody raised against a partial recombinant FBXW7.
Host:: Mouse
Immunogen:: FBXW7 (NP_361014, 599 a.a. ~ 707 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Isotype:: IgG2a, kappa
Reactivities:: Human
Sequence:: ADSTVKIWDIKTGQCLQTLQGPNKHQSAVTCLQFNKNFVITSSDDGTVKLWDLKTGEFIRNLVTLESGGSGGVVWRIRASNTKLVCAVGSRNGTEETKLLVLDFDVDMK
Shipping Conditions:: Blue Ice
Storage Conditions:: -20[o]C Aliquot. Avoid freeze/thaw cycles.
Supplier:: Abnova
Type:: Antibody: Monoclonal Antibody

Basket