Recombinant rat Apolipo protein A-V
Product Sizes
100 ug
OPCA00012-100UG
1 mg
OPCA00012-1MG
20 ug
OPCA00012-20UG
About this Product
- SKU:
- OPCA00012
- Additional Names:
- apoA-V;apo-AV;Apolipoprotein A5;apolipoprotein A-V;regeneration-associated protein 3.|apolipoprotein A5
- Buffer:
- Liquid or Lyophilized powder
- Extra Details:
- Minor apolipoprotein mainly associated with HDL and to a lesser extent with VLDL. May also be associated with chylomicrons. Important determinant of plasma triglyceride (TG) levels by both being a potent stimulator of apo-CII lipoprotein lipase (LPL) TG hydrolysis and a inhibitor of the hepatic VLDL-TG production rate (without affecting the VLDL-apoB production rate). Activates poorly lecithin:cholesterol acyltransferase (LCAT) and does not enhance efflux of cholesterol from macrophages (By similarity).
- Formulation:
- Liquid or Lyophilized powder
- Immunogen:
- Apoa5
- Molecular Weight:
- 66.4 kDa
- Purity:
- >90%
- Reactivities:
- Rat
- Sequence:
- RKSFWEYFGQNSQGKGMMGQQQKLAQESLKGSLEQDLYNMNNFLEKLGPLREPGKEPPRLAQDPEGIRKQLQQELEEVSTRLEPYMAAKHQQVGWNLEGLRQQLKPYTVELMEQVGLSVQDLQEQLRMVGKGTKAQLLGGVDEAMSLLQDMQSRVLHHTDRVKELFHPYAERLVTGIGHHVQELHRSVAPHAVASPARLSRCVQTLSHKLTRKAKDLHTSIQRNLDQLRDELSTFIRVSTDGADNRDSLDPQALSDEVRQRLQAFRHDTYLQIAAFTQAIDQETEEIQHQLAPPPPSHSAFAPELGHSDSNKALSRLQSRLDDLWEDIAYGLHDQGHSQNNPEGHSG
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C
- Supplier:
- Aviva Systems Biology
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Manufacturer's Data Sheet:html_datasheet.php