Big Endothelin (1-38) human
Product Sizes
0.5 mg
ECH-331-30-0.5MG
1 mg
ECH-331-30-1MG
About this Product
- SKU:
- ECH-331-30
- Extra Details:
- CAS Number: 121014-53-7Molecular Weight: 4283.98Salt Form: TFAPurity: >95%Sequence (3-letter): Cys-Ser-Cys-Ser-Ser-Leu-Met-Asp-Lys-Glu-Cys-Val-Tyr-Phe-Cys-His-Leu-Asp-Ile-Ile-Trp-Val-Asn-Thr-Pro-Glu-His-Val-Val-Pro-Tyr-Gly-Leu-Gly-Ser-Pro-Arg-Ser-OH [Cys1-Cys15 Cys3-Cys11]Sequence (1-letter): CSCSSLMDKECVYFCHLDIIWVNTPEHVVPYGLGSPRS-OHStorage: -20 °C or belowBig Endothelin (1-38) is the precursor to the vasoconstricting peptide endothelin-1. It is cleaved by endothelin-converting enzyme (ECE).
- Molecular Weight:
- 4283.98
- Sequence:
- Cys-Ser-Cys-Ser-Ser-Leu-Met-Asp-Lys-Glu-Cys-Val-Tyr-Phe-Cys-His-Leu-Asp-Ile-Ile-Trp-Val-Asn-Thr-Pro-Glu-His-Val-Val-Pro-Tyr-Gly-Leu-Gly-Ser-Pro-Arg-Ser-OH [Cys1-Cys15 Cys3-Cys11]
- Shipping Conditions:
- Ambient
- Storage Conditions:
- -20[o]C
- Supplier:
- Echelon Biosciences
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Peptides
- Manufacturer's Data Sheet:https://www.echelon-inc.com/product/big-endothelin-1-38-human/
