anti-FABP5 antibody
About this Product
- SKU:
- ARG58575
- Additional Names:
- PA-FABP; Epidermal-type fatty acid-binding protein; KFABP; EFABP; E-FABP; Psoriasis-associated fatty acid-binding protein homolog; Fatty acid-binding protein, epidermal; Fatty acid-binding protein 5; PAFABP
- Application:
- IHC-Paraffin, Western Blot
- Buffer:
- 0.9% NaCl, 0.2% Na2HPO4, 0.05% Sodium azide and 4% Trehalose.
- CE/IVD:
- RUO
- Clonality:
- Polyclonal
- Concentration:
- 0.5 mg/ml
- Extra Details:
- This gene encodes the fatty acid binding protein found in epidermal cells, and was first identified as being upregulated in psoriasis tissue. Fatty acid binding proteins are a family of small, highly conserved, cytoplasmic proteins that bind long-chain fatty acids and other hydrophobic ligands. FABPs may play roles in fatty acid uptake, transport, and metabolism. Polymorphisms in this gene are associated with type 2 diabetes. The human genome contains many pseudogenes similar to this locus.[provided by RefSeq, Feb 2011]
- Host:
- Rabbit
- Immunogen:
- Synthetic peptide corresponding to a sequence of Mouse FABP5. (KWRLMESHGFEEYMKELGVGLALRKMAAMAKPD).
- Isotype:
- IgG
- Purification:
- Purified
- Reactivities:
- Mouse, Rat
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C
- Supplier:
- Arigo Biolaboratories
- Type:
- Antibody: Polyclonal Antibody
- Manufacturer's Data Sheet:ARG58575.html





