Anti-MFF Antibody
Product Sizes
100 ul
75-366-100UL
About this Product
- SKU:
- 75-366
- Additional Names:
- Mitochondrial fission factor
- Application:
- Immunocytochemistry, Immunohistochemistry, Western Blot
- Buffer:
- 10 mM Tris, 50 mM Sodium Chloride
- CE/IVD:
- RUO
- translate.label.attr.clone:
- N382/14
- Clonality:
- Monoclonal
- Concentration:
- 1 mg/ml
- Extra Details:
- Our Anti-MFF mouse monoclonal primary antibody from NeuroMab is produced in-house from hybridoma clone N382/14. It is KO validated, detects human, mouse, and rat MFF, and is purified by Protein A chromatography. It is great for use in IHC, ICC, WB.
- Formulation:
- 10 mM Tris, 50 mM Sodium Chloride, 0.065% Sodium Azide pH 7.125
- Host:
- Mouse
- Immunogen:
- Fusion protein amino acids 1-173 (MSKRTSSDTPLGRVSGAAFPSPTASEMAEISRIQYEMEYTEGIS QRMRVPEKLKVAPPNADLEQGFQEGVPNASVIMQVPERIVVAGNNEDVSFSRPADLDLIQS TPFKPLALKTPPRVLTLSERPLDFLDLERPPVTPQNEEIRAVGRLKRERSMSENAVRQNGQL VRNDSV, cytoplasmic N-terminal exons 1, 2, 3 and 4) and 272-322 (YGISNIEATIEGTSDDM TVVDAASLRRQIIKLNRRLQLLEEENKERAKREM, cytoplasmic N-terminal exons 8 and most of 9) of mostly human MFF (also known as Mitochondrial fission factor, C2orf33, AD030, AD033 and GL004, accession number Q9GZY8); Human: 96% identity (167/173 amino acids identical) and 94% identity (48/51 amino acids identical); Rat: 95% identity (141/147 amino acids identical) and 92% identity (47/51 amino acids identical); Mouse: 93% identity (138/147 amino acids identical) and 84% identity (43/51 amino acids identical)
- Isotype:
- IgG1
- Molecular Weight:
- 40 kDa
- Physical State:
- Liquid
- Purification:
- Protein A Purified
- Reactivities:
- Human, Mouse, Rat
- Shipping Conditions:
- Blue Ice
- Specificity:
- No cross-reactivity reported
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- Antibodies Incorporated
- Type:
- Antibody: Monoclonal Antibody
