p53 Antibody (Acetyl-Lys379)
Product Sizes
100 ug
OAAF08186-100UG
About this Product
- SKU:
- OAAF08186
- Additional Names:
- antigen NY-CO-13;BCC7;BMFS5;cellular tumor antigen p53;LFS1;mutant tumor protein 53;P53;p53 tumor suppressor;phosphoprotein p53;transformation-related protein 53;TRP53;tumor protein 53;Tumor suppressor p53;tumor supressor p53.|tumor protein p53
- Application:
- ELISA, IHC-Paraffin, Immunocytochemistry, Immunofluorescence, Western Blot
- Clonality:
- Polyclonal
- Concentration:
- 1 mg/ml
- Extra Details:
- Acts as a tumor suppressor in many tumor types; induces growth arrest or apoptosis depending on the physiological circumstances and cell type. Involved in cell cycle regulation as a trans-activator that acts to negatively regulate cell division by controlling a set of genes required for this process. One of the activated genes is an inhibitor of cyclin-dependent kinases. Apoptosis induction seems to be mediated either by stimulation of BAX and FAS antigen expression, or by repression of Bcl-2 expression. In cooperation with mitochondrial PPIF is involved in activating oxidative stress-induced necrosis; the function is largely independent of transcription. Induces the transcription of long intergenic non-coding RNA p21 (lincRNA-p21) and lincRNA-Mkln1. LincRNA-p21 participates in TP53-dependent transcriptional repression leading to apoptosis and seem to have to effect on cell-cycle regulation. Implicated in Notch signaling cross-over. Prevents CDK7 kinase activity when associated to CAK complex in response to DNA damage, thus stopping cell cycle progression. Isoform 2 enhances the transactivation activity of isoform 1 from some but not all TP53-inducible promoters. Isoform 4 suppresses transactivation activity and impairs growth suppression mediated by isoform 1. Isoform 7 inhibits isoform 1-mediated apoptosis. Regulates the circadian clock by repressing CLOCK-ARNTL/BMAL1-mediated transcriptional activation of PER2 (PubMed:24051492).
- Host:
- Rabbit
- Immunogen:
- The antiserum was produced against synthesized peptide derived from human p53 around the acetylated site of Lys379.
- Molecular Weight:
- 43 kDa
- Purification:
- Affinity Purified
- Reactivities:
- Human, Mouse, Rat
- Sequence:
- Synthetic peptide located within the following region: LNEALELKDAQAGKEPGGSRAHSSHLKSKKGQSTSRHKKLMFKTEGPDSD
- Shipping Conditions:
- Blue Ice
- Specificity:
- p53 (Acetyl-Lys379) Antibody detects endogenous levels of total p53 protein only when acetylated at Lys379.
- Storage Conditions:
- -20[o]C
- Supplier:
- Aviva Systems Biology
- Type:
- Antibody: Polyclonal Antibody
- Manufacturer's Data Sheet:html_datasheet.php
