Growth Hormone antagonist (G119R)
Product Sizes
10 ug
£277.65
500-018-10UG
50 ug
£404.71
500-018-50UG
About this Product
- SKU:
- 500-018
- Additional Names:
- Somatotropin, GH, GH-N, Growth Hormone 1, Pituitary growth hormone
- Extra Details:
- Recombinant rat GH-22K G119R produced in E. coli is a single, non-glycosylated, polypeptide chain containing 191 amino acids and having a molecular mass of 22 kDa. It is mutated in single amino acid (G119R) according to similar bovine GH mutein described by Chen et al. (1991), Molecular Endocrinology 5:1845-1852.
- Formulation:
- lyophilized
- Host:
- E. coli
- Molecular Weight:
- 22.0 KkDa
- Purity:
- > 98.0% as determined by RP-HPLC, Gel filtration and SDS-PAGE Silver Stained gel.
- Sequence:
- AAFPAMPLSSLFANAVLRAQHLHQLAADTYKEFERAYIPEGQRYSIQNAQAAFCFSETIPAPTGKEEAQQRTDMELLRFSLLLIQSWLGPVQFLSRIFTNSLMFGTSDRVYEKLKDLEERIQALMQELEDGSPRIGQILKQTYDKFDANMRSDDALLKNYGLLSCFKKDLHKAETYLRVMKCRRFAESSCAF
- Shipping Conditions:
- Ambient
- Storage Conditions:
- Room Temperature
- Supplier:
- ReliaTech
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins