ACE2 antibody
Product Sizes
ACE2 antibody
£720.00
70R-7469-100UL
About this Product
- SKU:
- 70R-7469-100UL
- Application:
- Western Blot
- Clonality:
- Polyclonal
- Extra Details:
- This is a rabbit polyclonal antibody against ACE2, which has been validated by Western Blot. We usually provide antibodies covering each member of a whole protein family of your interest. We also use our best efforts to provide you antibodies recognize various epitopes of a target protein. For availability of antibody needed for your experiment, please inquire at antibodies@fitzgerald-fii.com
- Immunogen:
- ACE2 antibody was raised using a synthetic peptide corresponding to a region with amino acids FVTAPKNVSDIIPRTEVEKAIRMSRSRINDAFRLNDNSLEFLGIQPTLGP
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Size:
- 100 ul
- Supplier:
- Fitzgerald
- Type:
- Antibody: Polyclonal Antibody
- Manufacturer's Data Sheet:ace2-antibody-70r-7469.html