AK5 antibody
Product Sizes
AK5 antibody
70R-3556-100UL
About this Product
- SKU:
- 70R-3556-100UL
- Application:
- Western Blot
- Clonality:
- Polyclonal
- Extra Details:
- This is a rabbit polyclonal antibody against AK5, which has been validated by Western Blot. We usually provide antibodies covering each member of a whole protein family of your interest. We also use our best efforts to provide you antibodies recognize various epitopes of a target protein. For availability of antibody needed for your experiment, please inquire at antibodies@fitzgerald-fii.com
- Immunogen:
- AK5 antibody was raised using the N terminal of AK5 corresponding to a region with amino acids ESDTDLSETAELIEEYEVFDPTRPRPKIILVIGGPGSGKGTQSLKIAERY
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Size:
- 100 ul
- Supplier:
- Fitzgerald
- Type:
- Antibody: Polyclonal Antibody
- Manufacturer's Data Sheet:ak5-antibody-70r-3556.html