Growth Hormone Releasing Factor (GRF) (1-29) amide human

Product Sizes

0.5 mg

ECH-531-75-0.5MG

1 mg

ECH-531-75-1MG

About this Product

SKU:: ECH-531-75
CAS Number:: 86168-78-7
Extra Details:: CAS Number: 86168-78-7 Molecular Weight: 3355.82 Salt Form: TFA Purity: >96% Sequence (3-letter): Tyr-Ala-Asp-Ala-Ile-Phe-Thr-Asn-Ser-Tyr-Arg-Lys-Val-Leu-Gly-Gln-Leu-Ser-Ala-Arg-Lys-Leu-Leu-Gln-Asp-Ile-Met-Ser-Arg-NH2 Sequence (1-letter): YADAIFTNSYRKVLGQLSARKLLQDIMSR-NH2 Storage: -20 °C or belowGrowth Hormone Releasing Factor (GHRF or GRF) is a peptide that stimulates the release of growth hormone via GPCR receptor GHRH-R. N-terminal fragments and modified fragments are used to study the biological roles of GHRF.
Molecular Weight:: 3355.82
Sequence:: Tyr-Ala-Asp-Ala-Ile-Phe-Thr-Asn-Ser-Tyr-Arg-Lys-Val-Leu-Gly-Gln-Leu-Ser-Ala-Arg-Lys-Leu-Leu-Gln-Asp-Ile-Met-Ser-Arg-NH2
Shipping Conditions:: Ambient
Storage Conditions:: -20[o]C
Supplier:: Echelon Biosciences
Type:: Proteins, Peptides, Small Molecules & Other Biomolecules: Peptides

Basket