CXCL10 Protein
Product Sizes
5 ug
OPCB00003-5UG
About this Product
- SKU:
- OPCB00003
- Additional Names:
- C7, IFI10, INP10, IP-10, crg-2, mob-1, SCYB10, gIP-10|chemokine (C-X-C motif) ligand 10
- Buffer:
- Lyophilized
- Extra Details:
- CXCL10 (IP-10) was originally identified as an IFN-gamma-inducible gene in endothelial, fibroblasts and monocytes cells. IP-10 is considered a member of the CXC chemokine subfamily from its protein sequence which includes the four conserved cysteine residues present in CXC chemokines. IP-10 signals through the CXCR3 receptor to selectively attract Th1 lymphocytes and monocytes. It also has angiostatic and mitogenic properties on vascular smooth muscle cells. A diverse population of cell types rapidly increases transcription of mRNA encoding IP-10, which suggests that gamma-induced protein may be a key mediator of the IFNG/IFN-gamma response.
- Formulation:
- Lyophilized
- Immunogen:
- CXCL10
- Molecular Weight:
- 8.646 kDa
- Physical State:
- Lyophilized
- Purity:
- >97%
- Sequence:
- The protein sequence is: VPLSRTVRCTCISISNQPVNPRSLEKLEIIPASQFCPRVEIIATMKKKGEKRCLNPESKAIKNLLKAVSKERSKRSP
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- Please refer to datasheet
- Supplier:
- Aviva Systems Biology
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Manufacturer's Data Sheet:html_datasheet.php