MRCA Recombinant Protein (Escherichia coli)
Product Sizes
100 ug
OPCA04426-100UG
1 mg
OPCA04426-1MG
20 ug
OPCA04426-20UG
About this Product
- SKU:
- OPCA04426
- Additional Names:
- b3396;ECK3383;peptidoglycan glycosyltransferase/peptidoglycan DD-transpeptidase MrcA;ponA.|peptidoglycan glycosyltransferase/peptidoglycan DD-transpeptidase MrcA
- Buffer:
- Liquid or Lyophilized powder
- Extra Details:
- Cell wall formation. Synthesis of cross-linked peptidoglycan from the lipid intermediates. The enzyme has a penicillin-insensitive transglycosylase N-terminal domain (formation of linear glycan strands) and a penicillin-sensitive transpeptidase C-terminal domain (cross-linking of the peptide subunits).
- Formulation:
- Liquid or Lyophilized powder
- Immunogen:
- mrcA
- Molecular Weight:
- 49.5 kDa
- Purity:
- >90%
- Reactivities:
- Bacteria
- Sequence:
- MLDEGYITQQQFDQTRTEAINANYHAPEIAFSAPYLSEMVRQEMYNRYGESAYEDGYRIYTTITRKVQQAAQQAVRNNVLDYDMRHGYRGPANVLWKVGESAWDNNKITDTLKALPTYGPLLPAAVTSANPQQATAMLADGSTVALSMEGVRWARPYRSDTQQGPTPRKVTDVLQTGQQIWVRQVGDAWWLAQVPEVNSALVSINPQNGAVMALVGGFDFNQSKFNRATQALRQVGSNIKPFLYTAAMDKGLTLASMLNDVPISRWDASAGSDWQPKNSPPQYAGPIRLRQGLGQSKNVVM
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C
- Supplier:
- Aviva Systems Biology
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Manufacturer's Data Sheet:html_datasheet.php