PPIA Recombinant Protein (Escherichia coli O157:H7)
Product Sizes
100 ug
OPCA04400-100UG
1 mg
OPCA04400-1MG
20 ug
OPCA04400-20UG
About this Product
- SKU:
- OPCA04400
- Additional Names:
- Cyclophilin A;ECs_4214;peptidyl-prolyl cis-trans isomerase A;Rotamase A.|peptidyl-prolyl cis-trans isomerase A
- Buffer:
- Liquid or Lyophilized powder
- Extra Details:
- PPIases accelerate the folding of proteins. It catalyzes the cis-trans isomerization of proline imidic peptide bonds in oligopeptides (By similarity).
- Formulation:
- Liquid or Lyophilized powder
- Immunogen:
- ppiA
- Molecular Weight:
- 34.1 kDa
- Purity:
- >90%
- Reactivities:
- Bacteria
- Sequence:
- AKGDPHVLLTTSAGNIELELDKQKAPVSVQNFVDYVNSGFYNNTTFHRVIPGFMIQGGGFTEQMQQKKPNPPIKNEADNGLRNTRGTIAMARTADKDSATSQFFINVADNAFLDHGQRDFGYAVFGKVVKGMDVADKISQVPTHDVGPYQNVPSKPVVILSAKVLP
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C
- Supplier:
- Aviva Systems Biology
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Manufacturer's Data Sheet:html_datasheet.php