DUSP14 Recombinant Protein
Product Sizes
100 ug
OPCA01575-100UG
1 mg
OPCA01575-1MG
20 ug
OPCA01575-20UG
About this Product
- SKU:
- OPCA01575
- Additional Names:
- dual specificity phosphatase 14|dual specificity protein phosphatase 14;MAP kinase phosphatase 6;mitogen-activated protein kinase phosphatase 6;MKP-1-like protein tyrosine phosphatase;MKP6;MKP-6;MKP-L.
- Buffer:
- Liquid or Lyophilized powder
- Extra Details:
- Involved in the inactivation of MAP kinases. Dephosphorylates ERK, JNK and p38 MAP-kinases.
- Formulation:
- Liquid or Lyophilized powder
- Immunogen:
- DUSP14
- Molecular Weight:
- 38.3 kDa
- Purity:
- >90%
- Reactivities:
- Human
- Sequence:
- MSSRGHSTLPRTLMAPRMISEGDIGGIAQITSSLFLGRGSVASNRHLLQARGITCIVNATIEIPNFNWPQFEYVKVPLADMPHAPIGLYFDTVADKIHSVSRKHGATLVHCAAGVSRSATLCIAYLMKFHNVCLLEAYNWVKARRPVIRPNVGFWRQLIDYERQLFGKSTVKMVQTPYGIVPDVYEKESRHLMPYWGI
- Shipping Conditions:
- Blue Ice
- Source:
- Human
- Storage Conditions:
- -20[o]C
- Supplier:
- Aviva Systems Biology
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Manufacturer's Data Sheet:html_datasheet.php