C1QA Recombinant Protein
Product Sizes
100 ug
OPCA01491-100UG
1 mg
OPCA01491-1MG
20 ug
OPCA01491-20UG
About this Product
- SKU:
- OPCA01491
- Additional Names:
- complement C1q A chain|complement C1q chain A;complement C1q subcomponent subunit A;complement component 1, q subcomponent, A chain;complement component 1, q subcomponent, alpha polypeptide;complement component C1q, A chain.
- Buffer:
- Liquid or Lyophilized powder
- Extra Details:
- C1q associates with the proenzymes C1r and C1s to yield C1, the first component of the serum complement system. The collagen-like regions of C1q interact with the Ca(2+)-dependent C1r(2)C1s(2) proenzyme complex, and efficient activation of C1 takes place on interaction of the globular heads of C1q with the Fc regions of IgG or IgM antibody present in immune complexes.
- Formulation:
- Liquid or Lyophilized powder
- Immunogen:
- C1QA
- Molecular Weight:
- 39.7 kda
- Purity:
- >90%
- Reactivities:
- Human
- Sequence:
- EDLCRAPDGKKGEAGRPGRRGRPGLKGEQGEPGAPGIRTGIQGLKGDQGEPGPSGNPGKVGYPGPSGPLGARGIPGIKGTKGSPGNIKDQPRPAFSAIRRNPPMGGNVVIFDTVITNQEEPYQNHSGRFVCTVPGYYYFTFQVLSQWEICLSIVSSSRGQVRRSLGFCDTTNKGLFQVVSGGMVLQLQQGDQVWVEKDPKKGHIYQGSEADSVFSGFLIFPSA
- Shipping Conditions:
- Blue Ice
- Source:
- Human
- Storage Conditions:
- -20[o]C
- Supplier:
- Aviva Systems Biology
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Manufacturer's Data Sheet:html_datasheet.php