anti-TFIIH p52 antibody
About this Product
- SKU:
- ARG59647
- Additional Names:
- General transcription factor IIH polypeptide 4; BTF2 p52; General transcription factor IIH subunit 4; TFB2; Basic transcription factor 2 52 kDa subunit; TFIIH; TFIIH basal transcription factor complex p52 subunit; P52
- Application:
- Western Blot
- Buffer:
- PBS, 0.09% (w/v) Sodium azide and 2% Sucrose.
- CE/IVD:
- RUO
- Clonality:
- Polyclonal
- Concentration:
- 0.5 - 1 mg/ml
- Host:
- Rabbit
- Immunogen:
- Synthetic peptide around the C-terminal region of Human TFIIH p52. (within the following region: LSQVDFELLLAHARELGVLVFENSAKRLMVVTPAGHSDVKRFWKRQKHSS)
- Isotype:
- IgG
- Purification:
- Protein A Purified; Affinity Purified
- Reactivities:
- Bovine, Canine, Fish, Goat, Guinea Pig, Human, Mouse, Rabbit, Rat
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C
- Supplier:
- Arigo Biolaboratories
- Type:
- Antibody: Polyclonal Antibody
- Manufacturer's Data Sheet:ARG59647.html
