anti-ARID1A antibody
About this Product
- SKU:
- ARG59223
- Additional Names:
- MRD14; BRG1-associated factor 250a; BAF250a; C1orf4; OSA1; SWI/SNF-related, matrix-associated, actin-dependent regulator of chromatin subfamily F member 1; hELD; SWI-like protein; BAF250; P270; BAF250A; ELD; SMARCF1; B120; BRG1-associated factor 250; ARID domain-containing protein 1A; SWI/SNF complex protein p270; AT-rich interactive domain-containing protein 1A; hOSA1; Osa homolog 1; BM029
- Application:
- Western Blot
- Buffer:
- 0.9% NaCl, 0.2% Na2HPO4, 0.05% Sodium azide and 5% BSA.
- CE/IVD:
- RUO
- Clonality:
- Polyclonal
- Concentration:
- 0.5 mg/ml
- Extra Details:
- This gene encodes a member of the SWI/SNF family, whose members have helicase and ATPase activities and are thought to regulate transcription of certain genes by altering the chromatin structure around those genes. The encoded protein is part of the large ATP-dependent chromatin remodeling complex SNF/SWI, which is required for transcriptional activation of genes normally repressed by chromatin. It possesses at least two conserved domains that could be important for its function. First, it has a DNA-binding domain that can specifically bind an AT-rich DNA sequence known to be recognized by a SNF/SWI complex at the beta-globin locus. Second, the C-terminus of the protein can stimulate glucocorticoid receptor-dependent transcriptional activation. It is thought that the protein encoded by this gene confers specificity to the SNF/SWI complex and may recruit the complex to its targets through either protein-DNA or protein-protein interactions. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jul 2008]
- Host:
- Rabbit
- Immunogen:
- Synthetic peptide corresponding to aa. 1021-1053 of Human ARID1A. (KMWVDRYLAFTEEKAMGMTNLPAVGRKPLDLYR).
- Isotype:
- IgG
- Purification:
- Affinity Purified
- Reactivities:
- Hamster, Human
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C
- Supplier:
- Arigo Biolaboratories
- Type:
- Antibody: Polyclonal Antibody
- Manufacturer's Data Sheet:ARG59223.html
