anti-ILF2 / NF45 antibody
About this Product
- SKU:
- ARG40964
- Additional Names:
- Interleukin enhancer-binding factor 2; NF45; Nuclear factor of activated T-cells 45 kDa; PRO3063
- Application:
- Western Blot
- Buffer:
- PBS, 0.09% (w/v) Sodium azide and 2% Sucrose.
- CE/IVD:
- RUO
- Clonality:
- Polyclonal
- Concentration:
- 0.5 - 1 mg/ml
- Extra Details:
- The protein encoded by this gene is a transcription factor required for T-cell expression of the interleukin 2 gene. It also binds RNA and is an essential component for encapsidation and protein priming of hepatitis B viral polymerase. The encoded 45 kDa protein (NF45, ILF2) forms a complex with the 90 kDa interleukin enhancer-binding factor 3 (NF90, ILF3), and this complex has been shown to affect the redistribution of nuclear mRNA to the cytoplasm, to repair DNA breaks by nonhomologous end joining, and to negatively regulate the microRNA processing pathway. Knockdown of NF45 or NF90 protein retards cell growth, possibly by inhibition of mRNA stabilization. Alternative splicing results in multiple transcript variants. Related pseudogenes have been found on chromosomes 3 and 14. [provided by RefSeq, Dec 2014]
- Host:
- Rabbit
- Immunogen:
- Synthetic peptide around the N-terminal region of Human ILF2. (within the following region: FPRVKPAPDETSFSEALLKRNQDLAPNSAEQASILSLVTKINNVIDNLIV)
- Isotype:
- IgG
- Purification:
- Affinity Purified
- Reactivities:
- Bovine, Canine, Fish, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C
- Supplier:
- Arigo Biolaboratories
- Type:
- Antibody: Polyclonal Antibody
- Manufacturer's Data Sheet:ARG40964.html
