anti-TRIM55 / MURF2 antibody
About this Product
- SKU:
- ARG40722
- Additional Names:
- Muscle-specific RING finger protein 2; muRF2; MuRF-2; MURF-2; RNF29; MuRF2; RING finger protein 29; Tripartite motif-containing protein 55
- Application:
- Western Blot
- Buffer:
- PBS, 0.09% (w/v) Sodium azide and 2% Sucrose.
- CE/IVD:
- RUO
- Clonality:
- Polyclonal
- Concentration:
- 0.5 - 1 mg/ml
- Extra Details:
- The protein encoded by this gene contains a RING zinc finger, a motif known to be involved in protein-protein interactions. This protein associates transiently with microtubules, myosin, and titin during muscle sarcomere assembly. It may act as a transient adaptor and plays a regulatory role in the assembly of sarcomeres. Four alternatively spliced transcript variants encoding distinct isoforms have been described. [provided by RefSeq, Jul 2008]
- Host:
- Rabbit
- Immunogen:
- Synthetic peptide around the N-terminal region of Human TRIM55. (within the following region: SGGRFRCPSCRHEVVLDRHGVYGLQRNLLVENIIDIYKQESTRPEKKSDQ)
- Isotype:
- IgG
- Purification:
- Affinity Purified
- Reactivities:
- Bovine, Canine, Fish, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C
- Supplier:
- Arigo Biolaboratories
- Type:
- Antibody: Polyclonal Antibody
- Manufacturer's Data Sheet:ARG40722.html
