FBXL19 monoclonal antibody (M03), clone 3C5
Product Sizes
100 ug
H00054620-M03-100UG
About this Product
- SKU:
- H00054620-M03
- Application:
- ELISA, Immunofluorescence, Western Blot
- translate.label.attr.clone:
- 3C5
- Clonality:
- Monoclonal
- Extra Details:
- Mouse monoclonal antibody raised against a partial recombinant FBXL19.
- Host:
- Mouse
- Immunogen:
- FBXL19 (NP_061958.1, 365 a.a. ~ 472 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
- Isotype:
- IgG1, kappa
- Reactivities:
- Human
- Sequence:
- RLLDLRWIEDVKDSQLRELLLPPPDTKPGQTESRGRLQGVAELRLAGLELTDASLRLLLRHAPQLSALDLSHCAHVGDPSVHLLTAPTSPLRETLVHLNLAGCHRLTD
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C Aliquot. Avoid freeze/thaw cycles.
- Supplier:
- Abnova
- Type:
- Antibody: Monoclonal Antibody
- Manufacturer's Data Sheet:H00054620-M03