AMPD2 monoclonal antibody (M01A), clone 2F5
Product Sizes
200 ul
H00000271-M01A-200UL
About this Product
- SKU:
- H00000271-M01A
- Application:
- ELISA, Western Blot
- translate.label.attr.clone:
- 2F5
- Clonality:
- Monoclonal
- Extra Details:
- Mouse monoclonal antibody raised against a partial recombinant AMPD2.
- Host:
- Mouse
- Immunogen:
- AMPD2 (NP_631895, 86 a.a. ~ 185 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
- Isotype:
- IgG1, kappa
- Reactivities:
- Human, Mouse, Rat
- Sequence:
- ISQDVKLEPDILLRAKQDFLKTDSDSDLQLYKEQGEGQGDRSLRERDVLEREFQRVTISGEEKCGVPFTDLLDAAKSVVRALFIREKYMALSLQSFCPTT
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C Aliquot. Avoid freeze/thaw cycles.
- Supplier:
- Abnova
- Type:
- Antibody: Monoclonal Antibody
- Manufacturer's Data Sheet:H00000271-M01A