AMH Recombinant Protein (Mouse)
Product Sizes
100 ug
OPCA05120-100UG
1 mg
OPCA05120-1MG
20 ug
OPCA05120-20UG
About this Product
- SKU:
- OPCA05120
- Additional Names:
- Anti-Muellerian hormone;Muellerian-inhibiting substance.
- Buffer:
- Liquid or Lyophilized powder
- Extra Details:
- This glycoprotein, produced by the Sertoli cells of the testis, causes regression of the Muellerian duct. It is also able to inhibit the growth of tumors derived from tissues of Muellerian duct origin.
- Formulation:
- Liquid or Lyophilized powder
- Immunogen:
- AMH
- Molecular Weight:
- 11.3 kDa
- Purity:
- >90%
- Purification:
- Affinity Purified
- Reactivities:
- Mouse
- Sequence:
- DKGQDGPCALRELSVDLRAERSVLIPETYQANNCQGACRWPQSDRNPRYGNHVVLLLKMQARGAALGRLPCCVPTAYAGKLLISLSEERISADHVPNMVATEC
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C
- Supplier:
- Aviva Systems Biology
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Manufacturer's Data Sheet:html_datasheet.php