YCIM Recombinant Protein (Escherichia coli)
Product Sizes
100 ug
OPCA04000-100UG
1 mg
OPCA04000-1MG
20 ug
OPCA04000-20UG
About this Product
- SKU:
- OPCA04000
- Additional Names:
- b1280;ECK1275;lipopolysaccharide assembly protein B;Lipopolysaccharide regulatory protein;yciM.|lipopolysaccharide assembly protein B
- Buffer:
- Liquid or Lyophilized powder
- Extra Details:
- Modulates cellular lipopolysaccharide (LPS) levels by regulating LpxC, which is involved in lipid A biosynthesis. May act by modulating the proteolytic activity of FtsH towards LpxC. May also coordinate assembly of proteins involved in LPS synthesis at the plasma membrane.
- Formulation:
- Liquid or Lyophilized powder
- Immunogen:
- lapB
- Molecular Weight:
- 58.8 kDa
- Purity:
- >90%
- Reactivities:
- Bacteria
- Sequence:
- WYMGRRSAQQNKQDEANRLSRDYVAGVNFLLSNQQDKAVDLFLDMLKEDTGTVEAHLTLGNLFRSRGEVDRAIRIHQTLMESASLTYEQRLLAIQQLGRDYMAAGLYDRAEDMFNQLTDETDFRIGALQQLLQIYQATSEWQKAIDVAERLVKLGKDKQRVEIAHFYCELALQHMASDDLDRAMTLLKKGAAADKNSARVSIMMGRVFMAKGEYAKAVESLQRVISQDRELVSETLEMLQTCYQQLGKTAEWAEFLQRAVEENTGADAELMLADIIEARDGSEAAQVYITRQLQRHPTMRVFHKLMDYHLNEAEEGRAKESLMVLRDMVGEKVRSKPRYRCQKCGFTAYTLYWHCPSCRAWSTIKPIRGLDGL
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C
- Supplier:
- Aviva Systems Biology
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Manufacturer's Data Sheet:html_datasheet.php