FGF21 Recombinant Protein (Mouse)
Product Sizes
100 ug
OPCA03854-100UG
About this Product
- SKU:
- OPCA03854
- Additional Names:
- Fgf8c;fibroblast growth factor 21;fibroblast growth factor 8c.|fibroblast growth factor 21
- Buffer:
- Liquid or Lyophilized powder
- Extra Details:
- Stimulates glucose uptake in differentiated adipocytes via the induction of glucose transporter SLC2A1/GLUT1 expression (but not SLC2A4/GLUT4 expression). Activity probably requires the presence of KLB.
- Formulation:
- Liquid or Lyophilized powder
- Immunogen:
- Fgf21
- Molecular Weight:
- 23.9 kDa
- Purity:
- >90%
- Reactivities:
- Mouse
- Sequence:
- AYPIPDSSPLLQFGGQVRQRYLYTDDDQDTEAHLEIREDGTVVGAAHRSPESLLELKALKPGVIQILGVKASRFLCQQPDGALYGSPHFDPEACSFRELLLEDGYNVYQSEAHGLPLRLPQKDSPNQDATSWGPVRFLPMPGLLHEPQDQAGFLPPEPPDVGSSDPLSMVEPLQGRSPSYAS
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C
- Supplier:
- Aviva Systems Biology
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Manufacturer's Data Sheet:html_datasheet.php