ADIPOQ Recombinant Protein
Product Sizes
100 ug
OPCA03018-100UG
20 ug
OPCA03018-20UG
About this Product
- SKU:
- OPCA03018
- Additional Names:
- 30 kDa adipocyte complement-related protein;ACRP30;adipocyte complement related 30kDa protein;adipocyte complement related protein of 30 kDa;adipocyte complement-related 30 kDa protein;adipocyte, C1q and collagen domain-containing protein;adiponectin;adipose most abundant gene transcript 1 protein;apM-1;APM1.|adiponectin, C1Q and collagen domain containing
- Buffer:
- Liquid or Lyophilized powder
- Extra Details:
- Important adipokine involved in the control of fat metabolism and insulin sensitivity, with direct anti-diabetic, anti-atherogenic and anti-inflammatory activities. Stimulates AMPK phosphorylation and activation in the liver and the skeletal muscle, enhancing glucose utilization and fatty-acid combustion. Antagonizes TNF-alpha by negatively regulating its expression in various tissues such as liver and macrophages, and also by counteracting its effects. Inhibits endothelial NF-kappa-B signaling through a cAMP-dependent pathway. May play a role in cell growth, angiogenesis and tissue remodeling by binding and sequestering various growth factors with distinct binding affinities, depending on the type of complex, LMW, MMW or HMW (By similarity).
- Formulation:
- Liquid or Lyophilized powder
- Immunogen:
- ADIPOQ
- Molecular Weight:
- 26.4 kDa
- Purity:
- >90%
- Reactivities:
- Bovine
- Sequence:
- EDNMEDPPLPKGACAGWMAGIPGHPGHNGTPGRDGRDGTPGEKGEKGDPGLVGPKGDTGETGITGIEGPRGFPGTPGRKGEPGESAYVYRSAFSVGLERQVTVPNVPIRFTKIFYNQQNHYDGTTGKFLCNIPGLYYFSYHITVYLKDVKVSLYKNDKALLFTHDQFQDKNVDQASGSVLLYLEKGDQVWLQVYEGENHNGVYADNVNDSTFTGFLLYHNIVE
- Shipping Conditions:
- Blue Ice
- Source:
- Bovine
- Storage Conditions:
- -20[o]C
- Supplier:
- Aviva Systems Biology
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Manufacturer's Data Sheet:html_datasheet.php