2.5 Recombinant Protein
Product Sizes
2.5 Recombinant Protein
OPCA02176
About this Product
- SKU:
- OPCA02176
- Additional Names:
- single-stranded DNA-binding protein|single-stranded DNA-binding protein;T7p17.
- Buffer:
- Liquid or Lyophilized powder
- Extra Details:
- Single-stranded DNA-binding protein that eliminates secondary structure in long ssDNA formed on the lagging strand of the replication fork. Stimulates DNA polymerase activity and increases the efficiency of RNA primer synthesis by interacting with the DNA polymerase and the helicase/primase protein gp4. Disrupts loops, hairpins and other secondary structures present on ssDNA to reduce and eliminate pausing of viral DNA polymerase at specific sites during elongation.
- Formulation:
- Liquid or Lyophilized powder
- Immunogen:
- T7p17
- Molecular Weight:
- 41.9 kda
- Purity:
- >90%
- Reactivities:
- Virus
- Sequence:
- MAKKIFTSALGTAEPYAYIAKPDYGNEERGFGNPRGVYKVDLTIPNKDPRCQRMVDEIVKCHEEAYAAAVEEYEANPPAVARGKKPLKPYEGDMPFFDNGDGTTTFKFKCYASFQDKKTKETKHINLVVVDSKGKKMEDVPIIGGGSKLKVKYSLVPYKWNTAVGASVKLQLESVMLVELATFGGGEDDWADEVEENGYVASGSAKASKPRDEESWDEDDEESEEADEDGDF
- Shipping Conditions:
- Blue Ice
- Source:
- Enterobacteria phage T7
- Storage Conditions:
- -20[o]C
- Supplier:
- Aviva Systems Biology
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Manufacturer's Data Sheet:html_datasheet.php