KRAS Q61H Protein, Human, Recombinant, Biotinylated
Product Sizes
0.1 mg
KRAS61H-B-301-0.1MG
1 mg
KRAS61H-B-301-1MG
About this Product
- SKU:
- KRAS61H-B-301
- Application:
- Protein Engineering
- Conjugate:
- Biotin
- Extra Details:
- Recombinant KRAS Q61H protein with the N-terminal AviTag™ peptide and His-tag is produced in E. coli cells and site-specifically biotinylated at AviTag with BirA enzyme (https://amidbiosciences.com/collections/biotinylation-tools-streptavidins/products/bira-biotin-ligase-in-vitro-biotynilation) Sequence of recombinant human KRAS Q61H protein (amino acids 1 - 185; Q61H mutant variant of isoform KRAS4B (UNIPROT: P01116-2)) MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAGHEEYSAM RDQYMRTGEGFLCVFAINNTKSFEDIHHYREQIKRVKDSEDVPMVLVGNKCDLPSRTVDTKQAQD LARSYGIPFIETSAKTRQGVDDAFYTLVREIRKHKEKMSKDGKKKKKKSKTKC Loading of the KRAS proteins with nucleotides or nucleotides' analogs can be performed if requested.
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -70[o]C
- Supplier:
- Amid Biosciences
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Enzymes
- Manufacturer's Data Sheet:kras-q61h-protein-human-recombinant-biotinylated