KRAS G12V Protein, Human, Recombinant, AviTag
Product Sizes
0.1 mg
KRAS12V-301-0.1MG
About this Product
- SKU:
- KRAS12V-301
- Application:
- Protein Engineering
- Extra Details:
- Human KRAS protein is a small guanosine triphosphatase (GTPase) that is the component of the mitogen activated protein kinase (MAPK) signaling pathway. High occurrences of KRAS mutations in some types of cancers make KRAS one of the most important targets in oncology for drug development. Recombinant KRAS G12V protein with the N-terminal AviTag™ peptide and His-tag is produced in E. coli cells. Presence of AviTag™ peptide can be useful for a site-specific biotinylation with BirA enzyme (https://amidbiosciences.com/collections/proteins/products/bira-biotin-ligase). Sequence of recombinant human KRAS G12V protein (amino acids 1 - 185; G12V mutant variant of isoform KRAS4B (UNIPROT: P01116-2)) MTEYKLVVVGAVGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAGQEEYSAM RDQYMRTGEGFLCVFAINNTKSFEDIHHYREQIKRVKDSEDVPMVLVGNKCDLPSRTVDTKQAQD LARSYGIPFIETSAKTRQGVDDAFYTLVREIRKHKEKMSKDGKKKKKKSKTKC Loading of the KRAS proteins with nucleotides or nucleotides' analogs can be performed if requested.
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -70[o]C
- Supplier:
- Amid Biosciences
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Enzymes
- Manufacturer's Data Sheet:kras-g12v-protein-human-recombinant-avitag