Skip to content

Basket

You currently have no items in your basket.

Total (excl. vat) £0.00
View basket & checkout
Proteins and Peptides

KRAS G12D Protein, Human, Recombinant, AviTag

Product Sizes
0.1 mg
KRAS12D-301-0.1MG
About this Product
SKU:
KRAS12D-301
Application:
Protein Engineering
Extra Details:
Human KRAS protein is a small guanosine triphosphatase (GTPase) that is the component of the mitogen activated protein kinase (MAPK) signaling pathway. High occurrences of KRAS mutations in some types of cancers make KRAS one of the most important targets in oncology for drug development. Recombinant KRAS G12D protein with the N-terminal AviTag™ peptide and His-tag is produced in E. coli cells. Presence of AviTag™ peptide can be useful for a site-specific biotinylation with BirA enzyme (https://amidbiosciences.com/collections/proteins/products/bira-biotin-ligase). Sequence of recombinant human KRAS G12D protein (amino acids 1 - 185; G12D mutant variant of isoform KRAS4B (UNIPROT: P01116-2)) MTEYKLVVVGADGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAGQEEYSAM RDQYMRTGEGFLCVFAINNTKSFEDIHHYREQIKRVKDSEDVPMVLVGNKCDLPSRTVDTKQAQD LARSYGIPFIETSAKTRQGVDDAFYTLVREIRKHKEKMSKDGKKKKKKSKTKC Loading of the KRAS proteins with nucleotides or nucleotides' analogs can be performed if requested.
Shipping Conditions:
Blue Ice
Storage Conditions:
-70[o]C
Supplier:
Amid Biosciences
Type:
Proteins, Peptides, Small Molecules & Other Biomolecules: Enzymes