Growth Hormone Releasing Factor (GHRF) mouse
Product Sizes
0.5 mg
ECH-536-10-0.5MG
1 mg
ECH-536-10-1MG
About this Product
- SKU:
- ECH-536-10
- Extra Details:
- Growth Hormone Releasing Factor (GHRF somatocrinin) is a peptide hormone produced in the arcuate nucleus of the hypothamlus. It binds to the GHRH receptor in the anterior pituitary gland and subsequently stimulates growth hormone secretion.Molecular Weight: 5029.72Salt Form: TFAPurity: >96%Sequence (3-letter): His-Val-Asp-Ala-Ile-Phe-Thr-Thr-Asn-Tyr-Arg-Lys-Leu-Leu-Ser-Gln-Leu-Tyr-Ala-Arg-Lys-Val-Ile-Gln-Asp-Ile-Met-Asn-Lys-Gln-Gly-Glu-Arg-Ile-Gln-Glu-Gln-Arg-Ala-Arg-Leu-Ser-OHSequence (1-letter): HVDAIFTTNYRKLLSQLYARKVIQDIMNKQGERIQEQRARLS-OHStorage: -20 °C or below
- Molecular Weight:
- 5029.72
- Sequence:
- His-Val-Asp-Ala-Ile-Phe-Thr-Thr-Asn-Tyr-Arg-Lys-Leu-Leu-Ser-Gln-Leu-Tyr-Ala-Arg-Lys-Val-Ile-Gln-Asp-Ile-Met-Asn-Lys-Gln-Gly-Glu-Arg-Ile-Gln-Glu-Gln-Arg-Ala-Arg-Leu-Ser-OH
- Shipping Conditions:
- Ambient
- Storage Conditions:
- -20[o]C
- Supplier:
- Echelon Biosciences
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Peptides
- Manufacturer's Data Sheet:https://www.echelon-inc.com/product/grf-mouse/
