anti-ANGPTL2 antibody
About this Product
- SKU:
- ARG59313
- Additional Names:
- Angiopoietin-related protein 2; Angiopoietin-like protein 2; HARP; ARP2
- Application:
- IHC-Paraffin, Western Blot
- Buffer:
- 0.9% NaCl, 0.2% Na2HPO4, 0.05% Sodium azide and 5% BSA.
- CE/IVD:
- RUO
- Clonality:
- Polyclonal
- Concentration:
- 0.5 mg/ml
- Extra Details:
- Angiopoietins are members of the vascular endothelial growth factor family and the only known growth factors largely specific for vascular endothelium. Angiopoietin-1, angiopoietin-2, and angiopoietin-4 participate in the formation of blood vessels. ANGPTL2 protein is a secreted glycoprotein with homology to the angiopoietins and may exert a function on endothelial cells through autocrine or paracrine action. [provided by RefSeq, Jul 2008]
- Host:
- Rabbit
- Immunogen:
- Synthetic peptide corresponding to aa. 275-312 of Human ANGPTL2. (WRDCLQALEDGHDTSSIYLVKPENTNRLMQVWCDQRHD)
- Isotype:
- IgG
- Purification:
- Affinity Purified
- Reactivities:
- Human, Mouse, Rat
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C
- Supplier:
- Arigo Biolaboratories
- Type:
- Antibody: Polyclonal Antibody
- Manufacturer's Data Sheet:ARG59313.html
