anti-CCDC6 antibody
About this Product
- SKU:
- ARG59212
- Additional Names:
- TPC; PTC; D10S170; H4; Papillary thyroid carcinoma-encoded protein; Coiled-coil domain-containing protein 6; Protein H4; TST1
- Application:
- Flow Cytometry, Immunocytochemistry, Immunofluorescence, Western Blot
- Buffer:
- 0.9% NaCl, 0.2% Na2HPO4, 0.05% Sodium azide and 5% BSA.
- CE/IVD:
- RUO
- Clonality:
- Polyclonal
- Concentration:
- 0.5 mg/ml
- Extra Details:
- This gene encodes a coiled-coil domain-containing protein. The encoded protein is ubiquitously expressed and may function as a tumor suppressor. A chromosomal rearrangement resulting in the expression of a fusion gene containing a portion of this gene and the intracellular kinase-encoding domain of the ret proto-oncogene is the cause of thyroid papillary carcinoma.[provided by RefSeq, Sep 2010]
- Host:
- Rabbit
- Immunogen:
- Synthetic peptide corresponding to aa. 156-198 of Human CCDC6. (KAELEQHLEQEQEFQVNKLMKKIKKLENDTISKQLTLEQLRRE)
- Isotype:
- IgG
- Purification:
- Affinity Purified
- Reactivities:
- Avian, Bovine, Canine, Fish, Hamster, Horse, Human, Non-human Primate, Rabbit, Rat
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C
- Supplier:
- Arigo Biolaboratories
- Type:
- Antibody: Polyclonal Antibody
- Manufacturer's Data Sheet:ARG59212.html
