anti-ACVR2B / Activin Receptor Type IIB antibody
About this Product
- SKU:
- ARG42691
- Additional Names:
- Activin receptor type IIB; HTX4; ACTRIIB; EC 2.7.11.30; ACTR-IIB; Activin receptor type-2B; ActR-IIB
- Application:
- Western Blot
- Buffer:
- 0.2% Na2HPO4, 0.9% NaCl, 0.05% Sodium azide and 5% BSA.
- CE/IVD:
- RUO
- Clonality:
- Polyclonal
- Concentration:
- 0.5 mg/ml
- Extra Details:
- Activins are dimeric growth and differentiation factors which belong to the transforming growth factor-beta (TGF-beta) superfamily of structurally related signaling proteins. Activins signal through a heteromeric complex of receptor serine kinases which include at least two type I (I and IB) and two type II (II and IIB) receptors. These receptors are all transmembrane proteins, composed of a ligand-binding extracellular domain with cysteine-rich region, a transmembrane domain, and a cytoplasmic domain with predicted serine/threonine specificity. Type I receptors are essential for signaling; and type II receptors are required for binding ligands and for expression of type I receptors. Type I and II receptors form a stable complex after ligand binding, resulting in phosphorylation of type I receptors by type II receptors. Type II receptors are considered to be constitutively active kinases. This gene encodes activin A type IIB receptor, which displays a 3- to 4-fold higher affinity for the ligand than activin A type II receptor. [provided by RefSeq, Jul 2008]
- Host:
- Rabbit
- Immunogen:
- Synthetic peptide corresponding to aa. 431-466 of Human ACVR2B / Activin Receptor Type IIB. (VVHKKMRPTIKDHWLKHPGLAQLCVTIEECWDHDAE)
- Isotype:
- IgG
- Purification:
- Affinity Purified
- Reactivities:
- Bovine, Human, Rat
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C
- Supplier:
- Arigo Biolaboratories
- Type:
- Antibody: Polyclonal Antibody
- Manufacturer's Data Sheet:ARG42691.html
