anti-AMACR / p504S antibody
About this Product
- SKU:
- ARG40208
- Additional Names:
- AMACR; Alpha-Methylacyl-CoA Racemase; P504S; RACE; 2-Methylacyl-CoA Racemase; EC 5.1.99.4; AMACRD; CBAS4; RM
- Application:
- Western Blot
- Buffer:
- 0.9% NaCl, 0.2% Na2HPO4, 0.05% Sodium azide and 5% BSA.
- CE/IVD:
- RUO
- Clonality:
- Polyclonal
- Concentration:
- 0.5 mg/ml
- Extra Details:
- This gene encodes a racemase. The encoded enzyme interconverts pristanoyl-CoA and C27-bile acylCoAs between their (R)- and (S)-stereoisomers. The conversion to the (S)-stereoisomers is necessary for degradation of these substrates by peroxisomal beta-oxidation. Encoded proteins from this locus localize to both mitochondria and peroxisomes. Mutations in this gene may be associated with adult-onset sensorimotor neuropathy, pigmentary retinopathy, and adrenomyeloneuropathy due to defects in bile acid synthesis. Alternatively spliced transcript variants have been described. Read-through transcription also exists between this gene and the upstream neighboring C1QTNF3 (C1q and tumor necrosis factor related protein 3) gene.
- Host:
- Rabbit
- Immunogen:
- Synthetic peptide corresponding to aa. 208-246 of Human AMACR / p504S. (RGQNMLDGGAPFYTTYRTADGEFMAVGAIEPQFYELLIK)
- Isotype:
- IgG
- Purification:
- Affinity Purified
- Reactivities:
- Bovine, Horse, Human, Non-human Primate, Rat
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C
- Supplier:
- Arigo Biolaboratories
- Type:
- Antibody: Polyclonal Antibody
- Manufacturer's Data Sheet:ARG40208.html
