GTX57734
Aquaporin 4 antibody
Cannot supply to this region.
- SKU:
- GTX57734
- Additional Names:
- aquaporin 4 , AQP-4 , Miwc , WCH4
- Application:
- Flow Cytometry, IHC, WB, IF, ICC
- Concentration:
- 1 mg/ml
- Physical State:
- Liquid
- Species Reactivity:
- Human, Rat
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C Aliquot. Avoid freeze/thaw cycles. Store undiluted., 2-8[o]C Aliquot. Avoid freeze/thaw cycles. Store undiluted., -20[o]C/-70[o]C Aliquot. Avoid freeze/thaw cycles. Store undiluted.
- Supplier:
- Genetex
- Host:
- Rabbit
- Reactivities:
- Human, Mouse, Rat
- Buffer:
- PBS, 1% BSA, 0.05% Sodium azide.
- Immunogen:
- GST fusion protein with the sequence EYVFCPDVELKRRLKEAFSK AAQQTKGSYMEVEDNRSQVETEDLILKPGVVHVIDIDRGDEKKGK DSSGEVLSSV, corresponding to amino acid residues 249-323 of rat AQP4 (Accession P47863). Intracellular, C-terminus.
- Uniprot:
- P47863
- Synonyms:
- AQP-4;aquaporin-4;mercurial-insensitive water channel;Miwc;WCH4
- Extra Details:
- This gene encodes a member of the aquaporin family of intrinsic membrane proteins that function as water-selective channels in the plasma membranes of many cells. This protein is the predominant aquaporin found in brain and has an important role in brain water homeostasis. Alternatively spliced transcript variants encoding different isoforms have been described for this gene. A recent study provided evidence for translational readthrough in this gene and expression of an additional C-terminally extended isoform via the use of an alternative in-frame translation termination codon. [provided by RefSeq, Dec 2015]
- Shipping Conditions:
- Blue Ice