GTX54836
Kv1.4 antibody
Cannot supply to this region.
- SKU:
- GTX54836
- Additional Names:
- potassium voltage-gated channel subfamily A member 4 , KCHAN , Kv1.4 , Kv4 , RHK1 , RK3
- Application:
- IHC, WB, IF, ICC
- Concentration:
- 0.3 mg/ml
- Physical State:
- Liquid
- Species Reactivity:
- Human, Rat
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C Aliquot. Avoid freeze/thaw cycles. Store undiluted., 2-8[o]C Aliquot. Avoid freeze/thaw cycles. Store undiluted., -20[o]C/-70[o]C Aliquot. Avoid freeze/thaw cycles. Store undiluted.
- Supplier:
- Genetex
- Host:
- Rabbit
- Reactivities:
- Human, Mouse, Rat
- Buffer:
- PBS, 1% BSA, 5% Sucrose, 0.025% Sodium azide.
- Immunogen:
- GST fusion protein with sequence PYLPSNLLKKFRSSTSSSLGDKSEYLEMEEGVKESLCGKEEKCQGKGDDSETDKNNCSNAKAVETDV, corresponding to amino acid residues 589-655 (Intracellular, C-terminus) of rat KV1.4 (Accession : P15385).
- Uniprot:
- P15385
- Synonyms:
- KCHAN;Kv1.4;Kv4;potassium channel, voltage gated shaker related subfamily A, member 4;potassium voltage-gated channel subfamily A member 4;potassium voltage-gated channel, shaker-related subfamily, member 4;RCK4;RHK1;RK3;voltage-gated potassium channel subunit Kv1.4
- Extra Details:
- voltage-gated K+ channel; responsible for potassium permeability in excitable membranes [RGD, Feb 2006]
- Shipping Conditions:
- Blue Ice