GTX54835
Kv1.2 antibody

Cannot supply to this region.
- SKU:
- GTX54835
- Additional Names:
- potassium voltage-gated channel subfamily A member 2 , BK2 , NGK1
- Application:
- WB, IHC-Fr, IF, ICC
- Concentration:
- 0.8 mg/ml
- Physical State:
- Liquid
- Species Reactivity:
- Human, Rat
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C Aliquot. Avoid freeze/thaw cycles. Store undiluted., 2-8[o]C Aliquot. Avoid freeze/thaw cycles. Store undiluted., -20[o]C/-70[o]C Aliquot. Avoid freeze/thaw cycles. Store undiluted.
- Supplier:
- Genetex
- Host:
- Rabbit
- Reactivities:
- Human, Mouse, Rat
- Buffer:
- PBS, 1% BSA, 5% Sucrose, 0.025% Sodium azide.
- Immunogen:
- GST fusion protein with sequence YHRETEGEEQAQYLQVTSCPKIPSSPDLKK SRSASTISKSDYMEIQEGVNNSNEDFREENLKTANCTLANTNYVNITKMLTDV, corresponding to amino acid residues 417-499 (Intracellular, C-terminus) of rat KV1.2 (Accession : P63142).
- Uniprot:
- P63142
- Synonyms:
- BK2;NGK1;Potassium (K+) channel protein alpha 2, voltage dependent;potassium channel, voltage gated shaker related subfamily A, member 2;Potassium voltage gated channel shaker related subfamily member 2;potassium voltage-gated channel subfamily A member 2;potassium voltage-gated channel, shaker-related subfamily, member 2;RAK;RBK2;RCK5;voltage-gated potassium channel subunit Kv1.2
- Extra Details:
- delayed-rectifier K+ channel expressed in heart and brain [RGD, Feb 2006]
- Shipping Conditions:
- Blue Ice


