GTX54834
Kv1.1 antibody
Cannot supply to this region.
- SKU:
- GTX54834
- Additional Names:
- potassium voltage-gated channel, shaker-related subfamily, member 1 , AI840627 , Kca1-1 , Kv1.1 , MBK1 , Mk-1 , Shak , mceph
- Application:
- IHC, WB, IF, ICC, IP
- Concentration:
- 0.75 mg/ml
- Physical State:
- Liquid
- Species Reactivity:
- Human, Mouse
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C Aliquot. Avoid freeze/thaw cycles. Store undiluted., 2-8[o]C Aliquot. Avoid freeze/thaw cycles. Store undiluted., -20[o]C/-70[o]C Aliquot. Avoid freeze/thaw cycles. Store undiluted.
- Supplier:
- Genetex
- Host:
- Rabbit
- Reactivities:
- Human, Mouse, Rat
- Buffer:
- PBS, 1% BSA, 0.05% Sodium azide.
- Immunogen:
- GST fusion protein with sequence HRETEGEEQAQLLHV SSPNLASDSDLSRRSSSTISKSEYMEIEEDMNNSIAHYRQANIRTGNCTTADQNCVNKSKLLTDV, corresponding to amino acid residues 416-495 (Intracellular, C-terminus) of mouse KV1.1 (Accession : P16388), (MW: 36 kDa.).
- Uniprot:
- P16388
- Synonyms:
- AI840627;brain potassium channel protein-1;Kca1-1;Kv1.;Kv1.1;MBK1;mcep;mceph;megencephaly;Mk-1;MKI;potassium voltage-gated channel subfamily A member 1;Sh;Shak;voltage-gated potassium channel subunit Kv1.1
- Shipping Conditions:
- Blue Ice