GTX54785
Kv11.1 antibody
Cannot supply to this region.
- SKU:
- GTX54785
- Additional Names:
- potassium voltage-gated channel subfamily H member 2 , ERG-1 , ERG1 , H-ERG , HERG , HERG1 , Kv11.1 , LQT2 , SQT1
- Application:
- IHC, WB, IF, ICC, IP
- Concentration:
- 0.6 mg/ml
- Physical State:
- Liquid
- Species Reactivity:
- Human
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C Aliquot. Avoid freeze/thaw cycles. Store undiluted., 2-8[o]C Aliquot. Avoid freeze/thaw cycles. Store undiluted., -20[o]C/-70[o]C Aliquot. Avoid freeze/thaw cycles. Store undiluted.
- Supplier:
- Genetex
- Host:
- Rabbit
- Reactivities:
- Human, Mouse, Rat
- Buffer:
- PBS, 1% BSA, 0.025% Sodium azide.
- Immunogen:
- GST fusion protein with sequence DSLSQVSQFMACEELPPGAPELPQEGPTRRLSLPGQLGALTSQPLHRHGSDPGS, corresponding to amino acid residues 1106-1159 (Intracellular, C-terminus) of human Kv11.1 (HERG) (Accession : Q12809), (MW: 35 kDa.).
- Uniprot:
- Q12809
- Synonyms:
- eag homolog;eag-related protein 1;ERG-1;ERG1;ether-a-go-go-related gene potassium channel 1;ether-a-go-go-related potassium channel protein;ether-a-go-go-related protein 1;H-ERG;HERG;HERG1;human ether-a-go-go-related;Kv11.1;long QT syndrome type 2;LQT2;potassium channel, voltage gated eag related subfamily H, member 2;potassium voltage-gated channel subfamily H member 2;potassium voltage-gated channel, subfamily H (eag-related), member 2;SQT1;voltage-gated potassium channel subunit Kv11.1
- Extra Details:
- This gene encodes a voltage-activated potassium channel belonging to the eag family. It shares sequence similarity with the Drosophila ether-a-go-go (eag) gene. Mutations in this gene can cause long QT syndrome type 2 (LQT2). Transcript variants encoding distinct isoforms have been identified. [provided by RefSeq, Jul 2008]
- Shipping Conditions:
- Blue Ice