KCNJ1 / ROMK antibody

Cannot supply to this region.

SKU:: GTX54775
Additional Names:: potassium voltage-gated channel subfamily J member 1 , KAB-1 , Kcnj , Kcnj1_v1 , Kcnj1_v3 , ROMK1 , ROMK2 , ROMK3 , kir1.1
Application:: WB, IHC-Fr, IF, ICC, IP
Concentration:: 0.8 mg/ml
Physical State:: Liquid
Species Reactivity:: Human, Rat
Purification:: Affinity Purified
Storage Conditions:: -20[o]C Aliquot. Avoid freeze/thaw cycles. Store undiluted., 2-8[o]C Aliquot. Avoid freeze/thaw cycles. Store undiluted., -20[o]C/-70[o]C Aliquot. Avoid freeze/thaw cycles. Store undiluted.
Supplier:: Genetex
Host:: Rabbit
Reactivities:: Human, Mouse, Rat
Buffer:: PBS, 1% BSA, 0.025% Sodium azide.
Immunogen:: GST fusion protein with sequence HNFGKTVEVETPHCAMCLYNEKDARARMKRGYDNPNFVLSEVDET DDTQM, corresponding to amino acids 342-391 ( Intracellular, C-terminus) of rat KCNJ1 (Accession : P35560), (MW: 33 kDa).
Synonyms:: ATP-regulated potassium channel ROM-K;ATP-sensitive inward rectifier potassium channel 1;inward rectifier K(+) channel Kir1.1;K+ channel protein;KAB-1;Kcnj;Kcnj1_v1;Kcnj1_v3;kir1.1;potassium channel, inwardly rectifying subfamily J member 1;potassium voltage-gated channel subfamily J member 1, variant 1;potassium voltage-gated channel subfamily J member 1, variant 3;ROMK1;ROMK2;ROMK3
Extra Details:: potassium channel involved in K+ secretion in the renal distal nephron [RGD, Feb 2006]